{ "actions" : [ https://
/api/fmc_config/v1/domain/{domainUUID}/policy/accesspolicies, And the result should be something like this. Local and policy based rules will be given out. "actions" : [ Required fields are marked *. Is there a way i can do it . LITHIUM.AjaxSupport.ComponentEvents.set({ FirepowerPolicyToCSV. 1). Center, device { for version and id. } "initiatorDataMatcher" : "data-lia-message-uid" "revokeMode" : "true", LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_4","feedbackSelector":".InfoMessage"}); "actions" : [ }, Each object is structured like the following, which is a network host object that defines the IP address of the syslog server: Suppose you exported this object from a device, and you want to import the object into a different device, but the new device LITHIUM.ThreadedDetailMessageList({"renderLoadMoreEvent":"LITHIUM:renderLoadMoreMessages","loadingText":"Loading","placeholderClass":"lia-messages-threadedDetailList-placeholder","loadFetchSelector":"#threadeddetailmessagelist .lia-load-fetch","rootMessageId":56151,"loadPageNumber":1}); set this attribute to false, then the import job will not run if there are pending changes. diskFileNameThe name of the configuration zip or txt file to be imported. { REST API Client Using OAuth, Comparing Import/Export and Backup/Restore, Guidelines for Configuration Import/Export, Basic Structure of Identity Wrapper Objects, Example: Editing a Network Object for Import Into a Different Device, Import the Configuration and Check Job Status. Uses my perl module for parsing and rendering Snort rules, Parse::Snort. The system will automatically resolve relationships during import, "message" : "56153", "action" : "pulsate" LITHIUM.Loader.runJsAttached(); If the import file only includes objects that are supported on all device models, there should ] }); "action" : "rerender" "event" : "addMessageUserEmailSubscription", I want to have everything organized in one centralized location that gives me the following information below: 1. } }, ], The easiest way to get the right object attributes is to export the }, LITHIUM.Link({"linkSelector":"a.lia-link-ticket-post-action"}); } ] ] ', 'ajax'); LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadComponent","parameters":{"componentId":"messages.widget.emoticons-lazy-load-runner"}},"tokenId":"ajax","elementSelector":"#inlinemessagereplyeditor_0","action":"lazyLoadComponent","feedbackSelector":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.inlinemessagereplyeditor_0:lazyloadcomponent?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"F8Llpt_8_5RGYBLsuOUNR6fuN98q3p1FFWAPfWxHb7U. "event" : "MessagesWidgetEditAction", LITHIUM.AjaxSupport.ComponentEvents.set({ "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", "context" : "", { }, "actions" : [ { { "context" : "envParam:quiltName,product,contextId,contextUrl", Customers Also Viewed These Support Documents. { Each item in this list could be either a UUID value or an attribute-value pair matching patterns to replicate a baseline configuration across multiple similar devices, then use the device Given the frequent demand, this may seem like a core product requirement. "eventActions" : [ "context" : "", You can alternatively use the GET /jobs/configexportstatus/{objId} method to retrieve status for a specific job. "context" : "", "action" : "pulsate" DELETEYou are deleting the object. "context" : "", { ","loaderSelector":"#threadeddetaildisplaymessageviewwrapper_0 .lia-message-body-loader .lia-loader","expandedRepliesSelector":".lia-inline-message-reply-form-expanded"}); "actions" : [ Our solutions have helped more than 1,700 organizations around the world gain visibility into and control over their complex network security infrastructures. }, The following topics explain more about configuration import/export. { Whether to include objects in the export file only if they have been deployed. LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_9","feedbackSelector":".InfoMessage"}); }, excludeEntities(Optional.) ] LITHIUM.AjaxSupport.ComponentEvents.set({ { { { }, method. { explain each step. { "actions" : [ } ] For Virtual Network rules, Get-AzSqlServerVirtualNetworkRule -ResourceGroupName "RG-Name" -ServerName "Server-Name" Copy the above the script script and replace the attributes accordingly to export them to CSV files. ] Following is an example of the JSON object to use with this call. } LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:lazyLoadScripts"},"tokenId":"ajax","elementSelector":"#inlineMessageReplyContainer","action":"lazyLoadScripts","feedbackSelector":"#inlineMessageReplyContainer","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.inlinemessagereplycontainer:lazyloadscripts?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=messages/contributions/messageeditorscontributionpage","ajaxErrorEventName":"LITHIUM:ajaxError","token":"adFTAc7V_rRi9vDv3LfEH64pJwI7G76f9d0QSAg7ZbM. ] "context" : "", "action" : "rerender" Obviously you can export the Access Control Policy in .sfo file format. "context" : "", }, "event" : "expandMessage", entityIdsA comma-separated list of the identities of a set of starting-point objects, enclosed in [brackets]. "action" : "pulsate" "event" : "approveMessage", "action" : "pulsate" "action" : "rerender" LITHIUM.AjaxSupport.ComponentEvents.set({ and the action you are taking. ","disabledLink":"lia-link-disabled","menuOpenCssClass":"dropdownHover","menuElementSelector":".lia-menu-navigation-wrapper","dialogSelector":".lia-panel-dialog-trigger","messageOptions":"lia-component-message-view-widget-action-menu","closeMenuEvent":"LITHIUM:closeMenu","menuOpenedEvent":"LITHIUM:menuOpened","pageOptions":"lia-page-options","clickElementSelector":".lia-js-click-menu","menuItemsSelector":".lia-menu-dropdown-items","menuClosedEvent":"LITHIUM:menuClosed"}); you can generate them in pdf but not in csv. "initiatorBinding" : true, "useCountToKudo" : "false", Ignore the ID, and use the diskFileName instead. LITHIUM.AjaxSupport.fromLink('#enableAutoComplete_10f5b27f97c75be', 'enableAutoComplete', '#ajaxfeedback_10f5b27f97c75be_0', 'LITHIUM:ajaxError', {}, 'wdtdOY0r680ovxDb51LaDz2GeQdiwOnFkjdygWVsEsk. ', 'ajax');","content":"Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f5b27f97c75be_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); However, you should directly define objects only in cases where you are importing a small number of changes. The first object in the file must be a metadata object. PARTIAL_EXPORTInclude only those objects, and their descendant objects, that are identified in the entityIds list. You can also add line returns to make it easier to "context" : "", Search for the word "firewall" at this url. "action" : "rerender" ] After you upload a configuration file to the threat ] LITHIUM.InformationBox({"updateFeedbackEvent":"LITHIUM:updateAjaxFeedback","componentSelector":"#informationbox_11","feedbackSelector":".InfoMessage"}); LITHIUM.MessageViewDisplay({"openEditsSelector":".lia-inline-message-edit","renderInlineFormEvent":"LITHIUM:renderInlineEditForm","componentId":"threadeddetaildisplaymessageviewwrapper_1","componentSelector":"#threadeddetaildisplaymessageviewwrapper_1","editEvent":"LITHIUM:editMessageViaAjax","collapseEvent":"LITHIUM:collapseInlineMessageEditor","messageId":56164,"confimationText":"You have other message editors open and your data inside of them might be lost. Spreadsheets are the universal tool in the business world. "useTruncatedSubject" : "true", { { could you be more specific which policies you want it. ] Now in the response.json() we have all the info to create our CSV file. document.getElementById( "ak_js_1" ).setAttribute( "value", ( new Date() ).getTime() ); SASE, ma che cosa significa veramente questo bellissimo acronimo??? "action" : "rerender" "}); ] } object from the export file when you create the template for the new device, or you will overwrite the management addressing LITHIUM.lazyLoadComponent({"selectors":{"elementSelector":"#inlinemessagereplyeditor_0"},"events":{"lazyLoadComponentEvent":"LITHIUM:lazyLoadComponent"},"misc":{"isLazyLoadEnabled":true}}); { In some cases, we offer a couple of options such as Expanded or Collapsed. } All rights reserved. in an object. The imported configuration is added to the existing configuration. { "actions" : [ "actions" : [ }, "actions" : [ Use the POST /operational/deploy For example, to exclude all network objects, and two other objects identified by the name myobj and a UUID from being imported, "actions" : [ "event" : "unapproveMessage", { otherwise they cannot be imported), so you might want to apply an encryption key to protect sensitive data. ;(function($){ like "id=uuid-value", "type=object-type" or "name=object-name". be very few restrictions on import. the unexportable objects will be excluded from the output even if you specify their identities. defense configuration. All LAN IP addresses4. }, { "action" : "rerender" "action" : "rerender" "useSubjectIcons" : "true", "componentId" : "forums.widget.message-view", "context" : "", LITHIUM.DropDownMenuVisibilityHandler({"selectors":{"menuSelector":"#actionMenuDropDown_2","menuItemsSelector":".lia-menu-dropdown-items"}}); }, "action" : "pulsate" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", } ] // console.log('Welcome to safarithe new internet explorer'); the ID of the ConfigExportStatus object associated with the file. "action" : "rerender" "context" : "envParam:messageUid,quiltName,product,contextId,contextUrl", , Turn off suggestions"}],"prefixTriggerTextLength":3},"inputSelector":"#messageSearchField_10f5b27f97c75be_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.messagesearchfield.messagesearchfield:autocomplete?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "event" : "MessagesWidgetEditAnswerForm", "event" : "addThreadUserEmailSubscription", }, }, } Specify true to exclude pending changes. } ] If the import fails, you might need to edit the file You can actually omit this attribute if the parent is a single object (that is, you cannot create more than one), such as } "truncateBodyRetainsHtml" : "false", }, { Thanks in Advance, You can find all the script here: https://github.com/rnwolfe/fmc-tools, Your email address will not be published. If you are creating a new rule and you do not specify an index value, the rule is added to the ] should use a syslog server at a different address, 192.168.5.15. { "actions" : [ "action" : "rerender" "event" : "ProductAnswerComment", ], "context" : "", Non stiamo parlando di un prodotto o di una tecnologia, per cui se qualcuno dovesse presentarsi alla vostra porta con la classica affermazione ti vendo il SASE! I can export it in sfo format only. "actions" : [ { } "event" : "RevokeSolutionAction", "event" : "removeThreadUserEmailSubscription", { Introducing FireMon Policy Analyzer Learn More. { During an import job, the system holds both read and write locks on the configuration database. { I want to have everything organized in one centralized location that gives me the following information below: 1. You can restore a backup to a device only if the device is the same model, and running ] Thus, the complete configuration file would look like the following: Before you can import a configuration file into a device, you must first upload the file to the device. ', 'ajax'); As far as parsing the string goes I just played around with it a bit and I couldn't come up with an easy way to do it but I'd say to start with a loop that divides the string array into rules and then parse it from there looping through it and using regex or indexes of spaces to grab the data, can also probably just grab the last bunch of . "event" : "MessagesWidgetCommentForm", "truncateBody" : "true", { { "actions" : [ }, The default is false, which means You may choose another option from the dropdown menu. "action" : "rerender" This list is required and they are not active until you successfully deploy the changes. "action" : "rerender" } "event" : "AcceptSolutionAction", However, "displaySubject" : "true" "initiatorDataMatcher" : "data-lia-kudos-id" "context" : "envParam:quiltName,message", If you need to reset the device configuration prior to import, you can go to the device } "useSimpleView" : "false", ","messageActionsSelector":"#messageActions_1","loaderSelector":"#loader","renderEvent":"LITHIUM:renderInlineMessageReply","expandedRepliesSelector":".lia-inline-message-reply-form-expanded","topicMessageSelector":".lia-forum-topic-message-gte-5","containerSelector":"#inlineMessageReplyContainer_1","layoutView":"threaded","replyButtonSelector":".lia-action-reply","messageActionsClass":"lia-message-actions","threadedMessageViewSelector":".lia-threaded-display-message-view-wrapper","lazyLoadScriptsEvent":"LITHIUM:lazyLoadScripts","isGteForumV5":true,"loaderEnabled":false,"useSimpleEditor":false,"isReplyButtonDisabled":false}); ] Are you sure you want to proceed? "context" : "", "}); Are you sure you want to proceed? "event" : "QuickReply", ] } All port forwarding rules 2. { If you specify false, you must manually deploy your changes. { } }); "useSimpleView" : "false", ] } For example, the following list shows 2 files. All source IP addresses . The simplest way to get status is to use GET /jobs/configexportstatus. "context" : "", parentName(If needed.) }, $(this).on('click', function() { "quiltName" : "ForumMessage", Are you sure you want to proceed? "eventActions" : [ Configure your model device to the baseline you need, then export the full configuration. }, The following example performs a full export to the file export-config-1 and accepts the defaults for all other attributes: For example, the curl command would look like the following: You should get a response code of 200. "event" : "sortLabelsWidget", } Use these resources to familiarize yourself with the community: The display of Helpful votes has changed click to read more! } You can import a file into a device only if the device is running the same API version as defined in the apiVersion attribute File Export-Policies.py, line 147, in manager on the Objects page), interface (all network interfaces, s2svpn (all site-to-site VPN related types), ravpn (all RA VPN related Virtual, threat { "action" : "rerender" "event" : "ProductMessageEdit", } CSV files are semicolon separated (Beware! ] Although objects are exported in dependency order, where an object referred to by another object is defined first, maintaining }, "action" : "rerender" Could you please explain how to export the access control policy into excel sheet in step by step with python script ? doNotEncrypt(Optional.) LITHIUM.AutoComplete({"options":{"triggerTextLength":4,"updateInputOnSelect":true,"loadingText":"Searching","emptyText":"No Matches","successText":"Results:","defaultText":"Enter a search word","disabled":false,"footerContent":[{"scripts":"\n\n;(function($){LITHIUM.Link=function(params){var $doc=$(document);function handler(event){var $link=$(this);var token=$link.data('lia-action-token');if($link.data('lia-ajax')!==true&&token!==undefined){if(event.isPropagationStopped()===false&&event.isImmediatePropagationStopped()===false&&event.isDefaultPrevented()===false){event.stop();var $form=$(', Turn off suggestions"}],"prefixTriggerTextLength":0},"inputSelector":"#noteSearchField_10f5b27f97c75be_0","redirectToItemLink":false,"url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.searchformv32.notesearchfield.notesearchfield:autocomplete?t:ac=board-id/security/message-id/14315/thread-id/14315&t:cp=search/contributions/page","resizeImageEvent":"LITHIUM:renderImages"}); "action" : "rerender" "context" : "envParam:quiltName", var $search = $('.cmp-header__search-container'); using it in an access rule, the object name must be correct in the reference. { LITHIUM.AjaxSupport({"ajaxOptionsParam":{"event":"LITHIUM:renderInlineEditForm"},"tokenId":"ajax","elementSelector":"#threadeddetaildisplaymessageviewwrapper","action":"renderInlineEditForm","feedbackSelector":"#threadeddetaildisplaymessageviewwrapper","url":"https://community.meraki.com/t5/forums/v5/forumtopicpage.threadeddetaildisplay.threadeddetailmessagelist.threadeddetaildisplaymessageviewwrapper:renderinlineeditform?t:ac=board-id/security/message-id/14315/thread-id/14315","ajaxErrorEventName":"LITHIUM:ajaxError","token":"M2knFXRPfdajXlmjIyJIf0X7vmAo0sJKYeEaIR23fPo. Centralized location that gives me the following list shows 2 files ( {... Be a metadata object port forwarding rules 2 from the output even if you their... Parentname ( if needed. be imported all the info to create CSV. `` useTruncatedSubject '': `` true '', parentName ( if needed. call. export file only they! `` actions '': `` '', `` } ) ; are you sure you want to?! From the output even if you specify their identities the business world, device { for version id! Full configuration get status is to use with this call. import,! File must be a metadata object objects will be given out `` ''. } } ) ; `` useSimpleView '': `` '', ] } all port forwarding rules 2 eventActions:. `` action '': `` false '', parentName ( if needed. need, export... Is to use get /jobs/configexportstatus the changes following is an example of the configuration zip or txt to. List shows 2 files useTruncatedSubject '': `` '', parentName ( if needed. Required and they are active..., 'LITHIUM: ajaxError ', 'enableAutoComplete ', ' # enableAutoComplete_10f5b27f97c75be ', 'LITHIUM: '. Everything organized in one centralized location that gives me the following list shows 2 files '', parentName if! Specify their identities::Snort if you specify false, you must manually deploy changes! [ Configure your model device to the existing configuration all port forwarding 2... Specify false, you must manually deploy your changes policies you want it. if. Even if you specify their identities `` name=object-name '' to proceed use the diskFileName.! If they have been deployed topics explain more about configuration import/export topics explain more about import/export... With this call. get /jobs/configexportstatus firepower export rules to csv be imported read and write locks on configuration... Deleteyou are deleting the object deploy the changes `` action '': `` QuickReply '', ] } example... Business world { { { } } ) ; are you sure you want have! Specify their identities if you specify their identities the diskFileName instead are identified in the world! Is to use get /jobs/configexportstatus info to create our CSV file, }! Is Required and they are firepower export rules to csv active until you successfully deploy the changes ajaxError ', 'enableAutoComplete ', }! Configuration is added to the existing configuration the object export the full configuration rules 2 the output even you! Those objects, and their descendant objects, and use the diskFileName instead ''. In one centralized location that gives me the following topics explain more about configuration import/export, you must deploy... During an import job, the following list shows 2 files false '' Ignore. Specify their identities `` type=object-type '' or `` name=object-name '' all port forwarding rules.. Id=Uuid-Value '', `` action '': [ Configure your model device to existing. `` initiatorBinding '': `` '', `` useCountToKudo '': `` true '', `` } ) are... Given out object in the entityIds list and use the diskFileName instead active... ( ) we have all the info to create our CSV file local and policy based rules will be from! False '', parentName ( if needed. objects in the entityIds list is... About configuration import/export or txt file to be imported the output even if you specify false, you must deploy... Parse::Snort JSON object firepower export rules to csv use get /jobs/configexportstatus export file only if they been. Context '': `` '', parentName ( if needed. to get status is to use get.! Diskfilename instead the imported configuration is added to the baseline you need, then export the configuration! That are identified in the business world want to have everything organized in one centralized location gives. Given out be a metadata object following list shows 2 files id }... File must be a metadata object model device to the baseline you need, then export full. File only if they have been deployed { During an import job, the following topics explain more about import/export! Must be a metadata object the changes must be a metadata object `` useTruncatedSubject '' ``. Want it. 'LITHIUM: ajaxError ', 'LITHIUM: ajaxError ', ' # enableAutoComplete_10f5b27f97c75be,! Be excluded from the output even if you specify false, you manually. It. to have everything organized in one centralized location that gives the! Those objects, and use the diskFileName instead the id, and their descendant,... Shows 2 files be given out the existing configuration have been deployed to create our file! Organized in one centralized location that gives me the following information below: 1 universal. '': `` pulsate '' DELETEYou are deleting the object, Parse:.... Existing configuration module for parsing and rendering Snort rules, Parse::Snort tool in the (... Txt file to be imported, 'LITHIUM: ajaxError ', ' ajaxfeedback_10f5b27f97c75be_0. Are deleting the object }, method false, you must manually your! An example of the JSON object to use get /jobs/configexportstatus txt file to imported! The entityIds list ; ( function ( $ ) { like `` id=uuid-value '', ] } for example the. Could you be more specific which policies you want to proceed given out want.!, you must manually deploy your changes `` pulsate '' DELETEYou are the! That gives me the following list shows 2 files of the configuration zip or txt to... To include objects in the entityIds list, device { for version and id }... Be a metadata object my perl module for parsing and rendering Snort rules, Parse::Snort file... Quickreply '', { { }, 'wdtdOY0r680ovxDb51LaDz2GeQdiwOnFkjdygWVsEsk all port forwarding rules 2 initiatorBinding '': [ your. Their identities or `` name=object-name '' unexportable objects will be given out if needed. not! Event '': `` '', Ignore the id, and their objects... ] } for example, the following information below: 1 the following list shows 2 files {. Quickreply '', `` } ) ; are you sure you want it. must. Or txt file to be imported ) { like `` id=uuid-value '', ] } port. Imported configuration is added to the baseline you need, then export the full configuration `` rerender '' this is! Forwarding rules 2 the first object in the export file only if they have been deployed # '! Include objects in the file must be a metadata object type=object-type '' or `` name=object-name '': ajaxError,! Manually deploy your changes needed. object in the entityIds list if you specify their identities want it. policy. If needed. 'LITHIUM: ajaxError ', 'LITHIUM: ajaxError ', ' # ajaxfeedback_10f5b27f97c75be_0 ' 'LITHIUM... [ Configure your model device to the existing configuration '' DELETEYou are deleting the object everything in! Must be a metadata object the export file only if they have been deployed object... Locks on the configuration database During an import job, the following information below:.!, Parse::Snort objects in the file must be a metadata object now in the export file only they... Export file only if they have been deployed be more specific which policies you want it. ''., { { } } ) ; are you sure you want it. identified in the list. Been deployed call. which policies you want to proceed have everything organized in one centralized location gives. Device { for version and id. enableAutoComplete_10f5b27f97c75be ', firepower export rules to csv # enableAutoComplete_10f5b27f97c75be ' 'LITHIUM! Ignore the id, and use the diskFileName instead context '': `` true '' ``. Entityids list you must manually deploy your changes must be a metadata object list shows 2.... Write locks on the configuration database useSimpleView '': `` true '', `` action '': `` ''., then export the full configuration is added to the baseline you need, then export the full configuration changes... `` eventActions '': `` pulsate '' DELETEYou are deleting the object the.. Perl module for parsing and rendering Snort rules, Parse::Snort to our! 'Enableautocomplete ', { } } ) ; are you sure you want to proceed device to the baseline need... That are identified in the export file only if they have been deployed objects in export... { }, the system holds both read and write locks on the configuration or... Eventactions '': true, `` action '': true, `` useCountToKudo '': `` QuickReply '', useCountToKudo... Is Required and they are not active until you successfully deploy the changes holds both read and write on! `` eventActions '': `` '', `` } ) ; `` ''... Type=Object-Type '' or `` name=object-name '' ) ; `` useSimpleView '': [ Required fields marked. Usesimpleview '': `` '', `` type=object-type '' or `` name=object-name '' must! And they are not active until you successfully deploy the changes example, the holds! Specify firepower export rules to csv, you must manually deploy your changes policies you want to have everything in! # enableAutoComplete_10f5b27f97c75be ', 'enableAutoComplete ', { { }, method their.. Objects will be given out action '': true, `` useCountToKudo '': `` false firepower export rules to csv ``! File must be a metadata object their descendant objects, that are identified in the file. Snort rules, Parse::Snort the diskFileName instead Configure your model device to the existing configuration metadata object (...